PTH purified MaxPab rabbit polyclonal antibody (D01P)
  • PTH purified MaxPab rabbit polyclonal antibody (D01P)

PTH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005741-D01P
PTH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTH protein.
Información adicional
Size 100 ug
Gene Name PTH
Gene Alias PTH1
Gene Description parathyroid hormone
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTH (NP_000306.1, 1 a.a. ~ 115 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5741

Enviar un mensaje


PTH purified MaxPab rabbit polyclonal antibody (D01P)

PTH purified MaxPab rabbit polyclonal antibody (D01P)