PTGIR monoclonal antibody (M02), clone 2A7
  • PTGIR monoclonal antibody (M02), clone 2A7

PTGIR monoclonal antibody (M02), clone 2A7

Ref: AB-H00005739-M02
PTGIR monoclonal antibody (M02), clone 2A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTGIR.
Información adicional
Size 100 ug
Gene Name PTGIR
Gene Alias IP|MGC102830|PRIPR
Gene Description prostaglandin I2 (prostacyclin) receptor (IP)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5739
Clone Number 2A7
Iso type IgG1 Kappa

Enviar un mensaje


PTGIR monoclonal antibody (M02), clone 2A7

PTGIR monoclonal antibody (M02), clone 2A7