PTGDR purified MaxPab rabbit polyclonal antibody (D01P)
  • PTGDR purified MaxPab rabbit polyclonal antibody (D01P)

PTGDR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005729-D01P
PTGDR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PTGDR protein.
Información adicional
Size 100 ug
Gene Name PTGDR
Gene Alias AS1|ASRT1|DP|DP1|MGC49004
Gene Description prostaglandin D2 receptor (DP)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSVFYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSSTLQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPGTWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PTGDR (NP_000944.1, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5729

Enviar un mensaje


PTGDR purified MaxPab rabbit polyclonal antibody (D01P)

PTGDR purified MaxPab rabbit polyclonal antibody (D01P)