PSPH purified MaxPab mouse polyclonal antibody (B01P)
  • PSPH purified MaxPab mouse polyclonal antibody (B01P)

PSPH purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005723-B01P
PSPH purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSPH protein.
Información adicional
Size 50 ug
Gene Name PSPH
Gene Alias PSP
Gene Description phosphoserine phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSPH (NP_004568.2, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5723

Enviar un mensaje


PSPH purified MaxPab mouse polyclonal antibody (B01P)

PSPH purified MaxPab mouse polyclonal antibody (B01P)