PSME2 monoclonal antibody (M02), clone 1G4
  • PSME2 monoclonal antibody (M02), clone 1G4

PSME2 monoclonal antibody (M02), clone 1G4

Ref: AB-H00005721-M02
PSME2 monoclonal antibody (M02), clone 1G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PSME2.
Información adicional
Size 100 ug
Gene Name PSME2
Gene Alias PA28B|PA28beta|REGbeta
Gene Description proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,IP,S-ELISA,ELISA
Immunogen Prot. Seq MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSME2 (NP_002809, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5721
Clone Number 1G4
Iso type IgG2a Kappa

Enviar un mensaje


PSME2 monoclonal antibody (M02), clone 1G4

PSME2 monoclonal antibody (M02), clone 1G4