PSME1 purified MaxPab mouse polyclonal antibody (B01P)
  • PSME1 purified MaxPab mouse polyclonal antibody (B01P)

PSME1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005720-B01P
PSME1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSME1 protein.
Información adicional
Size 50 ug
Gene Name PSME1
Gene Alias IFI5111|MGC8628|PA28A|PA28alpha|REGalpha
Gene Description proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAMLRVQPEAQAKVDVFREDLCTKAENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSME1 (AAH00352, 1 a.a. ~ 249 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5720

Enviar un mensaje


PSME1 purified MaxPab mouse polyclonal antibody (B01P)

PSME1 purified MaxPab mouse polyclonal antibody (B01P)