PSMD13 purified MaxPab mouse polyclonal antibody (B02P)
  • PSMD13 purified MaxPab mouse polyclonal antibody (B02P)

PSMD13 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00005719-B02P
PSMD13 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PSMD13 protein.
Información adicional
Size 50 ug
Gene Name PSMD13
Gene Alias HSPC027|Rpn9|S11|p40.5
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MKDVPGFLQQSQSSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PSMD13 (NP_002808, 1 a.a. ~ 376 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5719

Enviar un mensaje


PSMD13 purified MaxPab mouse polyclonal antibody (B02P)

PSMD13 purified MaxPab mouse polyclonal antibody (B02P)