PSMD5 monoclonal antibody (M01), clone 3E2
  • PSMD5 monoclonal antibody (M01), clone 3E2

PSMD5 monoclonal antibody (M01), clone 3E2

Ref: AB-H00005711-M01
PSMD5 monoclonal antibody (M01), clone 3E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PSMD5.
Información adicional
Size 100 ug
Gene Name PSMD5
Gene Alias KIAA0072|MGC23145|S5B
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq QPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMD5 (AAH14478, 405 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5711
Clone Number 3E2
Iso type IgG1 Kappa

Enviar un mensaje


PSMD5 monoclonal antibody (M01), clone 3E2

PSMD5 monoclonal antibody (M01), clone 3E2