PSMB3 polyclonal antibody (A01)
  • PSMB3 polyclonal antibody (A01)

PSMB3 polyclonal antibody (A01)

Ref: AB-H00005691-A01
PSMB3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PSMB3.
Información adicional
Size 50 uL
Gene Name PSMB3
Gene Alias HC10-II|MGC4147
Gene Description proteasome (prosome, macropain) subunit, beta type, 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMB3 (AAH13008, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5691

Enviar un mensaje


PSMB3 polyclonal antibody (A01)

PSMB3 polyclonal antibody (A01)