PSMA5 polyclonal antibody (A01)
  • PSMA5 polyclonal antibody (A01)

PSMA5 polyclonal antibody (A01)

Ref: AB-H00005686-A01
PSMA5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PSMA5.
Información adicional
Size 50 uL
Gene Name PSMA5
Gene Alias MGC117302|MGC125802|MGC125803|MGC125804|PSC5|ZETA
Gene Description proteasome (prosome, macropain) subunit, alpha type, 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMA5 (NP_002781, 132 a.a. ~ 241 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5686

Enviar un mensaje


PSMA5 polyclonal antibody (A01)

PSMA5 polyclonal antibody (A01)