PRTN3 monoclonal antibody (M04), clone 2F10
  • PRTN3 monoclonal antibody (M04), clone 2F10

PRTN3 monoclonal antibody (M04), clone 2F10

Ref: AB-H00005657-M04
PRTN3 monoclonal antibody (M04), clone 2F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRTN3.
Información adicional
Size 100 ug
Gene Name PRTN3
Gene Alias ACPA|AGP7|C-ANCA|MBT|P29|PR-3
Gene Description proteinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRTN3 (NP_002768, 139 a.a. ~ 248 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5657
Clone Number 2F10
Iso type IgG2b Kappa

Enviar un mensaje


PRTN3 monoclonal antibody (M04), clone 2F10

PRTN3 monoclonal antibody (M04), clone 2F10