PRTN3 polyclonal antibody (A01)
  • PRTN3 polyclonal antibody (A01)

PRTN3 polyclonal antibody (A01)

Ref: AB-H00005657-A01
PRTN3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRTN3.
Información adicional
Size 50 uL
Gene Name PRTN3
Gene Alias ACPA|AGP7|C-ANCA|MBT|P29|PR-3
Gene Description proteinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRTN3 (NP_002768, 139 a.a. ~ 248 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5657

Enviar un mensaje


PRTN3 polyclonal antibody (A01)

PRTN3 polyclonal antibody (A01)