KLK10 monoclonal antibody (M01), clone 1G8
  • KLK10 monoclonal antibody (M01), clone 1G8

KLK10 monoclonal antibody (M01), clone 1G8

Ref: AB-H00005655-M01
KLK10 monoclonal antibody (M01), clone 1G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLK10.
Información adicional
Size 100 ug
Gene Name KLK10
Gene Alias NES1|PRSSL1
Gene Description kallikrein-related peptidase 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5655
Clone Number 1G8
Iso type IgG1 lambda

Enviar un mensaje


KLK10 monoclonal antibody (M01), clone 1G8

KLK10 monoclonal antibody (M01), clone 1G8