KLK10 purified MaxPab mouse polyclonal antibody (B01P)
  • KLK10 purified MaxPab mouse polyclonal antibody (B01P)

KLK10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005655-B01P
KLK10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KLK10 protein.
Información adicional
Size 50 ug
Gene Name KLK10
Gene Alias NES1|PRSSL1
Gene Description kallikrein-related peptidase 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLK10 (AAH02710.1, 1 a.a. ~ 276 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5655

Enviar un mensaje


KLK10 purified MaxPab mouse polyclonal antibody (B01P)

KLK10 purified MaxPab mouse polyclonal antibody (B01P)