KLK6 monoclonal antibody (M01), clone 4A10
  • KLK6 monoclonal antibody (M01), clone 4A10

KLK6 monoclonal antibody (M01), clone 4A10

Ref: AB-H00005653-M01
KLK6 monoclonal antibody (M01), clone 4A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLK6.
Información adicional
Size 100 ug
Gene Name KLK6
Gene Alias Bssp|Klk7|MGC9355|NEUROSIN|PRSS18|PRSS9|SP59|ZYME|hK6
Gene Description kallikrein-related peptidase 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLK6 (AAH15525, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5653
Clone Number 4A10
Iso type IgG2a Kappa

Enviar un mensaje


KLK6 monoclonal antibody (M01), clone 4A10

KLK6 monoclonal antibody (M01), clone 4A10