PRSS7 monoclonal antibody (M01), clone 3F8
  • PRSS7 monoclonal antibody (M01), clone 3F8

PRSS7 monoclonal antibody (M01), clone 3F8

Ref: AB-H00005651-M01
PRSS7 monoclonal antibody (M01), clone 3F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRSS7.
Información adicional
Size 100 ug
Gene Name PRSS7
Gene Alias ENTK|MGC133046
Gene Description protease, serine, 7 (enterokinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRSS7 (NP_002763, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5651
Clone Number 3F8
Iso type IgG2a Kappa

Enviar un mensaje


PRSS7 monoclonal antibody (M01), clone 3F8

PRSS7 monoclonal antibody (M01), clone 3F8