PRSS1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRSS1 purified MaxPab rabbit polyclonal antibody (D01P)

PRSS1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005644-D01P
PRSS1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRSS1 protein.
Información adicional
Size 100 ug
Gene Name PRSS1
Gene Alias MGC120175|MGC149362|TRP1|TRY1|TRY4|TRYP1
Gene Description protease, serine, 1 (trypsin 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRSS1 (NP_002760.1, 1 a.a. ~ 247 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5644

Enviar un mensaje


PRSS1 purified MaxPab rabbit polyclonal antibody (D01P)

PRSS1 purified MaxPab rabbit polyclonal antibody (D01P)