PRSS1 polyclonal antibody (A01)
  • PRSS1 polyclonal antibody (A01)

PRSS1 polyclonal antibody (A01)

Ref: AB-H00005644-A01
PRSS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRSS1.
Información adicional
Size 50 uL
Gene Name PRSS1
Gene Alias MGC120175|MGC149362|TRP1|TRY1|TRY4|TRYP1
Gene Description protease, serine, 1 (trypsin 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRSS1 (NP_002760, 138 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5644

Enviar un mensaje


PRSS1 polyclonal antibody (A01)

PRSS1 polyclonal antibody (A01)