PRPS2 monoclonal antibody (M02), clone 4C1
  • PRPS2 monoclonal antibody (M02), clone 4C1

PRPS2 monoclonal antibody (M02), clone 4C1

Ref: AB-H00005634-M02
PRPS2 monoclonal antibody (M02), clone 4C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRPS2.
Información adicional
Size 100 ug
Gene Name PRPS2
Gene Alias PRSII
Gene Description phosphoribosyl pyrophosphate synthetase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRPS2 (NP_002756, 160 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5634
Clone Number 4C1
Iso type IgG2a Kappa

Enviar un mensaje


PRPS2 monoclonal antibody (M02), clone 4C1

PRPS2 monoclonal antibody (M02), clone 4C1