PRPS2 polyclonal antibody (A01)
  • PRPS2 polyclonal antibody (A01)

PRPS2 polyclonal antibody (A01)

Ref: AB-H00005634-A01
PRPS2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRPS2.
Información adicional
Size 50 uL
Gene Name PRPS2
Gene Alias PRSII
Gene Description phosphoribosyl pyrophosphate synthetase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRPS2 (NP_002756, 160 a.a. ~ 269 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5634

Enviar un mensaje


PRPS2 polyclonal antibody (A01)

PRPS2 polyclonal antibody (A01)