PRPH monoclonal antibody (M02), clone 3B3
  • PRPH monoclonal antibody (M02), clone 3B3

PRPH monoclonal antibody (M02), clone 3B3

Ref: AB-H00005630-M02
PRPH monoclonal antibody (M02), clone 3B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRPH.
Información adicional
Size 100 ug
Gene Name PRPH
Gene Alias NEF4|PRPH1
Gene Description peripherin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRPH (NP_006253, 374 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5630
Clone Number 3B3
Iso type IgG2b Kappa

Enviar un mensaje


PRPH monoclonal antibody (M02), clone 3B3

PRPH monoclonal antibody (M02), clone 3B3