PROS1 polyclonal antibody (A01)
  • PROS1 polyclonal antibody (A01)

PROS1 polyclonal antibody (A01)

Ref: AB-H00005627-A01
PROS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PROS1.
Información adicional
Size 50 uL
Gene Name PROS1
Gene Alias PROS|PS21|PS22|PS23|PS24|PS25|PSA
Gene Description protein S (alpha)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GLLETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROS1 (NP_000304, 419 a.a. ~ 516 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5627

Enviar un mensaje


PROS1 polyclonal antibody (A01)

PROS1 polyclonal antibody (A01)