PRKX MaxPab rabbit polyclonal antibody (D01)
  • PRKX MaxPab rabbit polyclonal antibody (D01)

PRKX MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005613-D01
PRKX MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKX protein.
Información adicional
Size 100 uL
Gene Name PRKX
Gene Alias PKX1
Gene Description protein kinase, X-linked
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKTAKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKX (NP_005035.1, 1 a.a. ~ 358 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5613

Enviar un mensaje


PRKX MaxPab rabbit polyclonal antibody (D01)

PRKX MaxPab rabbit polyclonal antibody (D01)