MAP2K5 monoclonal antibody (M06), clone 1F6
  • MAP2K5 monoclonal antibody (M06), clone 1F6

MAP2K5 monoclonal antibody (M06), clone 1F6

Ref: AB-H00005607-M06
MAP2K5 monoclonal antibody (M06), clone 1F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP2K5.
Información adicional
Size 100 ug
Gene Name MAP2K5
Gene Alias HsT17454|MAPKK5|MEK5|PRKMK5
Gene Description mitogen-activated protein kinase kinase 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP2K5 (AAH08838, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5607
Clone Number 1F6
Iso type IgG1 Kappa

Enviar un mensaje


MAP2K5 monoclonal antibody (M06), clone 1F6

MAP2K5 monoclonal antibody (M06), clone 1F6