MAP2K2 purified MaxPab rabbit polyclonal antibody (D01P)
  • MAP2K2 purified MaxPab rabbit polyclonal antibody (D01P)

MAP2K2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005605-D01P
MAP2K2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAP2K2 protein.
Información adicional
Size 100 ug
Gene Name MAP2K2
Gene Alias FLJ26075|MAPKK2|MEK2|MKK2|PRKMK2
Gene Description mitogen-activated protein kinase kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAP2K2 (NP_109587.1, 1 a.a. ~ 400 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5605

Enviar un mensaje


MAP2K2 purified MaxPab rabbit polyclonal antibody (D01P)

MAP2K2 purified MaxPab rabbit polyclonal antibody (D01P)