MAPK13 monoclonal antibody (M01), clone 2C10-1C7
  • MAPK13 monoclonal antibody (M01), clone 2C10-1C7

MAPK13 monoclonal antibody (M01), clone 2C10-1C7

Ref: AB-H00005603-M01
MAPK13 monoclonal antibody (M01), clone 2C10-1C7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MAPK13.
Información adicional
Size 100 ug
Gene Name MAPK13
Gene Alias MGC99536|PRKM13|SAPK4|p38delta
Gene Description mitogen-activated protein kinase 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK13 (AAH00433.1, 1 a.a. ~ 365 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5603
Clone Number 2C10-1C7
Iso type IgG1 Kappa

Enviar un mensaje


MAPK13 monoclonal antibody (M01), clone 2C10-1C7

MAPK13 monoclonal antibody (M01), clone 2C10-1C7