MAPK13 purified MaxPab rabbit polyclonal antibody (D01P)
  • MAPK13 purified MaxPab rabbit polyclonal antibody (D01P)

MAPK13 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005603-D01P
MAPK13 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAPK13 protein.
Información adicional
Size 100 ug
Gene Name MAPK13
Gene Alias MGC99536|PRKM13|SAPK4|p38delta
Gene Description mitogen-activated protein kinase 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAPK13 (NP_002745.1, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5603

Enviar un mensaje


MAPK13 purified MaxPab rabbit polyclonal antibody (D01P)

MAPK13 purified MaxPab rabbit polyclonal antibody (D01P)