MAPK8 monoclonal antibody (M05), clone 4H5
  • MAPK8 monoclonal antibody (M05), clone 4H5

MAPK8 monoclonal antibody (M05), clone 4H5

Ref: AB-H00005599-M05
MAPK8 monoclonal antibody (M05), clone 4H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPK8.
Información adicional
Size 100 ug
Gene Name MAPK8
Gene Alias JNK|JNK1|JNK1A2|JNK21B1/2|PRKM8|SAPK1
Gene Description mitogen-activated protein kinase 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq HPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK8 (NP_620637, 318 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5599
Clone Number 4H5
Iso type IgG2b Kappa

Enviar un mensaje


MAPK8 monoclonal antibody (M05), clone 4H5

MAPK8 monoclonal antibody (M05), clone 4H5