MAPK1 polyclonal antibody (A01)
  • MAPK1 polyclonal antibody (A01)

MAPK1 polyclonal antibody (A01)

Ref: AB-H00005594-A01
MAPK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAPK1.
Información adicional
Size 50 uL
Gene Name MAPK1
Gene Alias ERK|ERK2|ERT1|MAPK2|P42MAPK|PRKM1|PRKM2|p38|p40|p41|p41mapk
Gene Description mitogen-activated protein kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPK1 (AAH17832, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5594

Enviar un mensaje


MAPK1 polyclonal antibody (A01)

MAPK1 polyclonal antibody (A01)