PRKG1 polyclonal antibody (A01)
  • PRKG1 polyclonal antibody (A01)

PRKG1 polyclonal antibody (A01)

Ref: AB-H00005592-A01
PRKG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKG1.
Información adicional
Size 50 uL
Gene Name PRKG1
Gene Alias CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha
Gene Description protein kinase, cGMP-dependent, type I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKG1 (NP_006249, 73 a.a. ~ 170 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5592

Enviar un mensaje


PRKG1 polyclonal antibody (A01)

PRKG1 polyclonal antibody (A01)