Ver mas grande
PRKG1 polyclonal antibody (A01)
AB-H00005592-A01
Producto nuevo
PRKG1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | PRKG1 |
| Gene Alias | CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha |
| Gene Description | protein kinase, cGMP-dependent, type I |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PRKG1 (NP_006249, 73 a.a. ~ 170 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 5592 |
Más información
Mouse polyclonal antibody raised against a partial recombinant PRKG1.