PRKCZ monoclonal antibody (M01), clone 2D1
  • PRKCZ monoclonal antibody (M01), clone 2D1

PRKCZ monoclonal antibody (M01), clone 2D1

Ref: AB-H00005590-M01
PRKCZ monoclonal antibody (M01), clone 2D1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKCZ.
Información adicional
Size 100 ug
Gene Name PRKCZ
Gene Alias PKC-ZETA|PKC2
Gene Description protein kinase C, zeta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq KLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCZ (AAH08058, 165 a.a. ~ 255 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5590
Clone Number 2D1
Iso type IgG2b Kappa

Enviar un mensaje


PRKCZ monoclonal antibody (M01), clone 2D1

PRKCZ monoclonal antibody (M01), clone 2D1