PRKCZ MaxPab mouse polyclonal antibody (B01P)
  • PRKCZ MaxPab mouse polyclonal antibody (B01P)

PRKCZ MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005590-B01P
PRKCZ MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRKCZ protein.
Información adicional
Size 50 ug
Gene Name PRKCZ
Gene Alias PKC-ZETA|PKC2
Gene Description protein kinase C, zeta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKCZ (NP_002735.3, 1 a.a. ~ 592 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5590

Enviar un mensaje


PRKCZ MaxPab mouse polyclonal antibody (B01P)

PRKCZ MaxPab mouse polyclonal antibody (B01P)