PKN2 monoclonal antibody (M01), clone 3A7
  • PKN2 monoclonal antibody (M01), clone 3A7

PKN2 monoclonal antibody (M01), clone 3A7

Ref: AB-H00005586-M01
PKN2 monoclonal antibody (M01), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PKN2.
Información adicional
Size 100 ug
Gene Name PKN2
Gene Alias MGC150606|MGC71074|PAK2|PRK2|PRKCL2|PRO2042|Pak-2
Gene Description protein kinase N2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKN2 (NP_006247, 580 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5586
Clone Number 3A7
Iso type IgG1 kappa

Enviar un mensaje


PKN2 monoclonal antibody (M01), clone 3A7

PKN2 monoclonal antibody (M01), clone 3A7