PRKCH purified MaxPab rabbit polyclonal antibody (D01P)
  • PRKCH purified MaxPab rabbit polyclonal antibody (D01P)

PRKCH purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005583-D01P
PRKCH purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKCH protein.
Información adicional
Size 100 ug
Gene Name PRKCH
Gene Alias MGC26269|MGC5363|PKC-L|PKCL|PRKCL|nPKC-eta
Gene Description protein kinase C, eta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKCH (NP_006246.2, 1 a.a. ~ 683 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5583

Enviar un mensaje


PRKCH purified MaxPab rabbit polyclonal antibody (D01P)

PRKCH purified MaxPab rabbit polyclonal antibody (D01P)