PRKCH polyclonal antibody (A02)
  • PRKCH polyclonal antibody (A02)

PRKCH polyclonal antibody (A02)

Ref: AB-H00005583-A02
PRKCH polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKCH.
Información adicional
Size 50 uL
Gene Name PRKCH
Gene Alias MGC26269|MGC5363|PKC-L|PKCL|PRKCL|nPKC-eta
Gene Description protein kinase C, eta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCH (NP_006246, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5583

Enviar un mensaje


PRKCH polyclonal antibody (A02)

PRKCH polyclonal antibody (A02)