PRKCD monoclonal antibody (M09A), clone 8H1
  • PRKCD monoclonal antibody (M09A), clone 8H1

PRKCD monoclonal antibody (M09A), clone 8H1

Ref: AB-H00005580-M09A
PRKCD monoclonal antibody (M09A), clone 8H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKCD.
Información adicional
Size 200 uL
Gene Name PRKCD
Gene Alias MAY1|MGC49908|PKCD|nPKC-delta
Gene Description protein kinase C, delta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5580
Clone Number 8H1
Iso type IgG2a Kappa

Enviar un mensaje


PRKCD monoclonal antibody (M09A), clone 8H1

PRKCD monoclonal antibody (M09A), clone 8H1