PRKCD purified MaxPab rabbit polyclonal antibody (D01P)
  • PRKCD purified MaxPab rabbit polyclonal antibody (D01P)

PRKCD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005580-D01P
PRKCD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKCD protein.
Información adicional
Size 100 ug
Gene Name PRKCD
Gene Alias MAY1|MGC49908|PKCD|nPKC-delta
Gene Description protein kinase C, delta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKCD (NP_006245.2, 1 a.a. ~ 676 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5580

Enviar un mensaje


PRKCD purified MaxPab rabbit polyclonal antibody (D01P)

PRKCD purified MaxPab rabbit polyclonal antibody (D01P)