PRKCB1 polyclonal antibody (A01)
  • PRKCB1 polyclonal antibody (A01)

PRKCB1 polyclonal antibody (A01)

Ref: AB-H00005579-A01
PRKCB1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKCB1.
Información adicional
Size 50 uL
Gene Name PRKCB
Gene Alias MGC41878|PKC-beta|PKCB|PRKCB1|PRKCB2
Gene Description protein kinase C, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKCB1 (AAH36472, 261 a.a. ~ 341 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5579

Enviar un mensaje


PRKCB1 polyclonal antibody (A01)

PRKCB1 polyclonal antibody (A01)