PRKAR2A monoclonal antibody (M01), clone 6A9
  • PRKAR2A monoclonal antibody (M01), clone 6A9

PRKAR2A monoclonal antibody (M01), clone 6A9

Ref: AB-H00005576-M01
PRKAR2A monoclonal antibody (M01), clone 6A9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKAR2A.
Información adicional
Size 100 ug
Gene Name PRKAR2A
Gene Alias MGC3606|PKR2|PRKAR2
Gene Description protein kinase, cAMP-dependent, regulatory, type II, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKAR2A (AAH02763, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5576
Clone Number 6A9
Iso type IgG1 Kappa

Enviar un mensaje


PRKAR2A monoclonal antibody (M01), clone 6A9

PRKAR2A monoclonal antibody (M01), clone 6A9