PRKAR1B purified MaxPab mouse polyclonal antibody (B01P)
  • PRKAR1B purified MaxPab mouse polyclonal antibody (B01P)

PRKAR1B purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005575-B01P
PRKAR1B purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRKAR1B protein.
Información adicional
Size 50 ug
Gene Name PRKAR1B
Gene Alias PRKAR1
Gene Description protein kinase, cAMP-dependent, regulatory, type I, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKAR1B (NP_002726.1, 1 a.a. ~ 381 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5575

Enviar un mensaje


PRKAR1B purified MaxPab mouse polyclonal antibody (B01P)

PRKAR1B purified MaxPab mouse polyclonal antibody (B01P)