PRKACG polyclonal antibody (A01)
  • PRKACG polyclonal antibody (A01)

PRKACG polyclonal antibody (A01)

Ref: AB-H00005568-A01
PRKACG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PRKACG.
Información adicional
Size 50 uL
Gene Name PRKACG
Gene Alias KAPG|PKACg
Gene Description protein kinase, cAMP-dependent, catalytic, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKACG (AAH39888, 1 a.a. ~ 351 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5568

Enviar un mensaje


PRKACG polyclonal antibody (A01)

PRKACG polyclonal antibody (A01)