PRKACB monoclonal antibody (M01), clone 2G8-1D12
  • PRKACB monoclonal antibody (M01), clone 2G8-1D12

PRKACB monoclonal antibody (M01), clone 2G8-1D12

Ref: AB-H00005567-M01
PRKACB monoclonal antibody (M01), clone 2G8-1D12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PRKACB.
Información adicional
Size 100 ug
Gene Name PRKACB
Gene Alias DKFZp781I2452|MGC41879|MGC9320|PKACB
Gene Description protein kinase, cAMP-dependent, catalytic, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKACB (AAH16285, 1 a.a. ~ 257 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5567
Clone Number 2G8-1D12
Iso type IgG1 kappa

Enviar un mensaje


PRKACB monoclonal antibody (M01), clone 2G8-1D12

PRKACB monoclonal antibody (M01), clone 2G8-1D12