PRKACA monoclonal antibody (M02), clone 1D7
  • PRKACA monoclonal antibody (M02), clone 1D7

PRKACA monoclonal antibody (M02), clone 1D7

Ref: AB-H00005566-M02
PRKACA monoclonal antibody (M02), clone 1D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKACA.
Información adicional
Size 100 ug
Gene Name PRKACA
Gene Alias MGC102831|MGC48865|PKACA
Gene Description protein kinase, cAMP-dependent, catalytic, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5566
Clone Number 1D7
Iso type IgG1 Kappa

Enviar un mensaje


PRKACA monoclonal antibody (M02), clone 1D7

PRKACA monoclonal antibody (M02), clone 1D7