PRKACA polyclonal antibody (A01)
  • PRKACA polyclonal antibody (A01)

PRKACA polyclonal antibody (A01)

Ref: AB-H00005566-A01
PRKACA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKACA.
Información adicional
Size 50 uL
Gene Name PRKACA
Gene Alias MGC102831|MGC48865|PKACA
Gene Description protein kinase, cAMP-dependent, catalytic, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5566

Enviar un mensaje


PRKACA polyclonal antibody (A01)

PRKACA polyclonal antibody (A01)