PRKAB2 polyclonal antibody (A01)
  • PRKAB2 polyclonal antibody (A01)

PRKAB2 polyclonal antibody (A01)

Ref: AB-H00005565-A01
PRKAB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRKAB2.
Información adicional
Size 50 uL
Gene Name PRKAB2
Gene Alias MGC61468
Gene Description protein kinase, AMP-activated, beta 2 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKAB2 (NP_005390, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5565

Enviar un mensaje


PRKAB2 polyclonal antibody (A01)

PRKAB2 polyclonal antibody (A01)