PRKAB1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PRKAB1 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAB1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005564-D01P
PRKAB1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PRKAB1 protein.
Información adicional
Size 100 ug
Gene Name PRKAB1
Gene Alias AMPK|HAMPKb|MGC17785
Gene Description protein kinase, AMP-activated, beta 1 non-catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRKAB1 (NP_006244.2, 1 a.a. ~ 270 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5564

Enviar un mensaje


PRKAB1 purified MaxPab rabbit polyclonal antibody (D01P)

PRKAB1 purified MaxPab rabbit polyclonal antibody (D01P)