Ver mas grande
PRKAA1 monoclonal antibody (M04), clone 3B6
AB-H00005562-M04
Producto nuevo
PRKAA1 monoclonal antibody (M04), clone 3B6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PRKAA1 |
| Gene Alias | AMPK|AMPKa1|MGC33776|MGC57364 |
| Gene Description | protein kinase, AMP-activated, alpha 1 catalytic subunit |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PRKAA1 (AAH12622, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 5562 |
| Clone Number | 3B6 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PRKAA1.