PRKAA1 monoclonal antibody (M03), clone 4D8
  • PRKAA1 monoclonal antibody (M03), clone 4D8

PRKAA1 monoclonal antibody (M03), clone 4D8

Ref: AB-H00005562-M03
PRKAA1 monoclonal antibody (M03), clone 4D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRKAA1.
Información adicional
Size 100 ug
Gene Name PRKAA1
Gene Alias AMPK|AMPKa1|MGC33776|MGC57364
Gene Description protein kinase, AMP-activated, alpha 1 catalytic subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRKAA1 (AAH12622, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5562
Clone Number 4D8
Iso type IgG2a Kappa

Enviar un mensaje


PRKAA1 monoclonal antibody (M03), clone 4D8

PRKAA1 monoclonal antibody (M03), clone 4D8