PRH2 monoclonal antibody (M03), clone 1E6
  • PRH2 monoclonal antibody (M03), clone 1E6

PRH2 monoclonal antibody (M03), clone 1E6

Ref: AB-H00005555-M03
PRH2 monoclonal antibody (M03), clone 1E6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PRH2.
Información adicional
Size 100 ug
Gene Name PRH2
Gene Alias DKFZp686B01256|DKFZp686F14256|DKFZp686I11251|DKFZp686J06255|DKFZp686L01253|DKFZp686L16244|DKFZp686M04243|DKFZp686N24248|Pr
Gene Description proline-rich protein HaeIII subfamily 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRH2 (NP_005033.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5555
Clone Number 1E6
Iso type IgG2a Kappa

Enviar un mensaje


PRH2 monoclonal antibody (M03), clone 1E6

PRH2 monoclonal antibody (M03), clone 1E6