PPT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PPT1 purified MaxPab rabbit polyclonal antibody (D01P)

PPT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005538-D01P
PPT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PPT1 protein.
Información adicional
Size 100 ug
Gene Name PPT1
Gene Alias CLN1|INCL|PPT
Gene Description palmitoyl-protein thioesterase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASPGCLWLLAVALLPWTCASRALQHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEKKIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQALAKDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERLVQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVDSEWFGFYRSGQAKET
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPT1 (NP_000301.1, 1 a.a. ~ 306 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5538

Enviar un mensaje


PPT1 purified MaxPab rabbit polyclonal antibody (D01P)

PPT1 purified MaxPab rabbit polyclonal antibody (D01P)